PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G217800.1.p
Common NameGLYMA_16G217800, LOC100785023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 719aa    MW: 79149 Da    PI: 6.7541
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G217800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.5e-202580156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ +++t++q+++Le++F+++++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Glyma.16G217800.1.p 25 KKRYHRHTANQIQRLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 80
                         678899***********************************************998 PP

2START174.37.8e-552254482206
                          HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
                START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                          +a  a++e +++ + +ep+W+k +   + ++ d + + f+++++       ++ea+r+sgvv+m+  +lv  ++d + +W e +      
  Glyma.16G217800.1.p 225 IASNAMEEMIRLLQTNEPLWMKGAdgrDVLDLDSYERMFPKANShlknpnVHVEASRDSGVVIMNGLTLVDMFMDPN-KWMELFStivtM 313
                          67889*******************999889999999999998889999999**************************.88888877777* PP

                          EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                          a t+evissg      g lqlm+ elq+lsplv+ R+f+f+Ry++q ++g w+ivdvS d +q+++  ++  R+++lpSg  i++++ng+
  Glyma.16G217800.1.p 314 ARTIEVISSGmmgghgGSLQLMYEELQVLSPLVStREFYFLRYCQQIEQGLWAIVDVSYDFTQDNQ-FAPQFRSHRLPSGVFIQDMPNGY 402
                          *****************************************************************9.8********************** PP

                          EEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 162 skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          skvtw+ehv+ ++++p h l+r ++ sg+a+ga++w+ tlqr ce+
  Glyma.16G217800.1.p 403 SKVTWIEHVEIEDKTPvHRLYRNIIYSGIAFGAQRWLTTLQRMCER 448
                          ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-20682IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-221176IPR009057Homeodomain-like
PROSITE profilePS5007118.0742282IPR001356Homeobox domain
SMARTSM003896.9E-192386IPR001356Homeobox domain
CDDcd000867.60E-192483No hitNo description
PfamPF000461.5E-172580IPR001356Homeobox domain
PROSITE patternPS0002705780IPR017970Homeobox, conserved site
PROSITE profilePS5084850.332215451IPR002913START domain
SuperFamilySSF559617.33E-36216449No hitNo description
CDDcd088751.77E-109219447No hitNo description
SMARTSM002344.6E-42224448IPR002913START domain
PfamPF018525.2E-47225448IPR002913START domain
Gene3DG3DSA:3.30.530.209.0E-9272445IPR023393START-like domain
SuperFamilySSF559611.14E-25469710No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MEFGSGSPGD RHHHHDGSSD SQRRKKRYHR HTANQIQRLE SMFKECPHPD EKQRLQLSRE  60
LGLAPRQIKF WFQNRRTQMK AQHERADNCA LRAENDKIRC ENIAIREALK NVICPSCGGP  120
PMNDDCYFDE QKLRLENAQL KEELDRVSSI AAKYIGRPIS QLPPVQPIHI SSLDLSMGTF  180
ASQGLGGPSL DLDLLPGSSS SSMPNVPPFQ PPCLSDMDKS LMSDIASNAM EEMIRLLQTN  240
EPLWMKGADG RDVLDLDSYE RMFPKANSHL KNPNVHVEAS RDSGVVIMNG LTLVDMFMDP  300
NKWMELFSTI VTMARTIEVI SSGMMGGHGG SLQLMYEELQ VLSPLVSTRE FYFLRYCQQI  360
EQGLWAIVDV SYDFTQDNQF APQFRSHRLP SGVFIQDMPN GYSKVTWIEH VEIEDKTPVH  420
RLYRNIIYSG IAFGAQRWLT TLQRMCERIA CLLVTGNSTR DLGGVIPSPE GKRSMMKLAQ  480
RMVTNFCASI SSSAGHRWTT LSGSGMNEVG VRVTVHKSSD PGQPNGVVLS AATTIWLPIP  540
PQTVFNFFKD EKKRPQWDVL SNGNAVQEVA HIANGSHPGN CISVLRAFNS SQNNMLILQE  600
SCVDSSGSLV VYCPVDLPAI NIAMSGEDPS YIPLLPSGFT ISPDGQADQD GGGASTSTSS  660
RVMGGGSGSG GSLITVAFQI LVSSLPSAKL NMESVTTVNS LIGNTVQHIK AALNCPSS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.423390.0cotyledon
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549189.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
RefseqXP_014624636.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A0B2QS980.0A0A0B2QS98_GLYSO; Homeobox-leucine zipper protein HDG11
TrEMBLI1MQL80.0I1MQL8_SOYBN; Uncharacterized protein
STRINGGLYMA16G34350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11